DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and CG33110

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster


Alignment Length:285 Identity:127/285 - (44%)
Similarity:169/285 - (59%) Gaps:33/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YIDSISRYM----DSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLV 67
            |...:.||.    :.:.|.|.|.:|:|..|..|..:...|:..|.|:||..|.:|||..|:.|||
  Fly    37 YTGLVQRYYQLVEEDYGDPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLV 101

  Fly    68 MYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSN 132
            :|||.||..|.::|||.||.||...|:.:||||||:|||:|:                       
  Fly   102 VYNAFQVALSGYMFYEHLMAGWLNYYNLKCQPVDYSDSPSSK----------------------- 143

  Fly   133 NPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHST 197
                 ||::.|:.||.||.|||.||:||||||||||:|.|||.||...|:..|..|||..||::|
  Fly   144 -----RMLNLCYLYYLSKLTEFADTMFFVLRKKSSQITWLHVYHHSVTPLETWVLVKFLAGGNAT 203

  Fly   198 FFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFID-CNYPKA 261
            |..|||.|||:.||.|||.:||||:|.|:||||||:|.||:.||:|.:.|..:.||.: |.:.|.
  Fly   204 FPNLLNNFVHVCMYFYYMMAAMGPEYAKFLWWKKYMTELQIAQFVLCIFHTLRALFSNQCQFSKF 268

  Fly   262 FVWWIGMHAVMFFFLFNEFYKAAYR 286
            ....:.::|.:||.||..||..:||
  Fly   269 ISALLLLNASIFFCLFMNFYMQSYR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 121/261 (46%)
CG33110NP_788716.1 ELO 61..294 CDD:279492 121/261 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449622
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.