DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and elovl4a

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_957090.1 Gene:elovl4a / 393769 ZFINID:ZDB-GENE-040426-1767 Length:309 Species:Danio rerio


Alignment Length:317 Identity:121/317 - (38%)
Similarity:176/317 - (55%) Gaps:35/317 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALIMKYI-DSISRYMDS--HSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNL 62
            |.:|...| |::..|..|  .:|.|.:.||:|.||.||||:..:|: |...|||:.|:.|:|..|
Zfish     1 MEIIQHIINDTVHFYKWSLTIADKRVEKWPLMDSPLPTLAISSSYL-LFLWLGPKYMQGREPFQL 64

  Fly    63 QNTLVMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQP 127
            :.||::||...|:.:.::|.|..:..                            ...:||:.|||
Zfish    65 RKTLIIYNFSMVILNFFIFKELFLAA----------------------------RAANYSYICQP 101

  Fly   128 VDYSNNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTP 192
            ||||::|..:|:..|.|||:.||..|::||:||:||||.:|::.|||.||..|....|.|:|:..
Zfish   102 VDYSDDPNEVRVAAALWWYFISKGVEYLDTVFFILRKKFNQISFLHVYHHCTMFTLWWIGIKWVA 166

  Fly   193 GGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCN 257
            ||.|.|...:|..:|::||.||..:|.||:.||:||||||||.:|||||.:.:.|....|:.||.
Zfish   167 GGQSFFGAHMNAAIHVLMYLYYGLAAFGPKIQKFLWWKKYLTIIQMVQFHVTIGHTALSLYSDCP 231

  Fly   258 YPKAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMK-KNGALANGHAKPNGYCKSINAH 313
            :||...|.:..:|:.|..||..||...||.:..: |..||.||.:  ||...|.|.:
Zfish   232 FPKWMHWCLIGYALTFIILFGNFYYQTYRRQPRRDKPRALHNGAS--NGALTSSNGN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 103/266 (39%)
elovl4aNP_957090.1 ELO 30..267 CDD:279492 103/265 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.