DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and Elovl4

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus


Alignment Length:310 Identity:118/310 - (38%)
Similarity:174/310 - (56%) Gaps:31/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALIMKYIDSIS--RYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQN 64
            |:...:.|::.  |:..|.:|.|.:.||:|.||:|||::...|:..| .|||:.|::|:|..::.
  Rat    14 AVSTAFNDTVEFYRWTWSIADKRVEDWPLMQSPWPTLSISTLYLLFV-WLGPKWMKDREPFQMRL 77

  Fly    65 TLVMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVD 129
            .|::||...|:.:.::|.|..|    |||:                        ..||:.||.||
  Rat    78 VLIIYNFGMVLLNLFIFRELFM----GSYN------------------------AGYSYICQSVD 114

  Fly   130 YSNNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGG 194
            |||:...:|:..|.|||:.||..|::||:||:||||::||:.|||.||..|....|.|:|:..||
  Rat   115 YSNDVNEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGG 179

  Fly   195 HSTFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYP 259
            .:.|...:|:|:|::||:||..:|.||..|||||||:|||.||:|||.:.:.|....|:.||.:|
  Rat   180 QAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTDCPFP 244

  Fly   260 KAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKS 309
            |...|.:..:|:.|.|||..||...|......|.|..|......||..||
  Rat   245 KWMHWALIAYAISFIFLFLNFYTRTYNEPKKSKTGKTATNGISANGVNKS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 104/265 (39%)
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 104/265 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.