DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and SPAC1B2.03c

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_593930.1 Gene:SPAC1B2.03c / 2542505 PomBaseID:SPAC1B2.03c Length:334 Species:Schizosaccharomyces pombe


Alignment Length:353 Identity:95/353 - (26%)
Similarity:149/353 - (42%) Gaps:91/353 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RTKGW------------PMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQV 74
            :|.||            ||  |.:.::.|.:|..|::.:.|..:|.|||||..:....::|.|..
pombe    34 KTIGWNPSEFEYIPGKTPM--SQWSSVIVSITAYYVIILSGRAIMTNRKPLKQRRLFQLHNFILT 96

  Fly    75 VFSA---WLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRT 136
            :.|.   .|..|.:...:..:..|.|    ..||             .|::.|...:.|.|    
pombe    97 IISGALLALLVEEVFRNYMRNGLFYC----VCDS-------------RHFTQRLVTLYYLN---- 140

  Fly   137 LRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTP--GGHSTFF 199
                      |.:|:.|.|||:|..|:||  .:..||..|||...:     :.||.  |..|..:
pombe   141 ----------YLTKYLELMDTVFLFLKKK--PLAFLHCYHHGITAL-----LCFTQLLGRTSVQW 188

  Fly   200 GL--LNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAF-----QLLFI--- 254
            |:  ||.:||::||:||..:|.|    :.:|||:::|.:|::||:|.::..:     .:.|.   
pombe   189 GVIGLNLYVHVIMYSYYFLAACG----RRVWWKQWVTRVQIIQFVLDLILCYFGTYSHIAFRYFP 249

  Fly   255 ------DCNYPKAFVWWIGMHAV-MFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINA 312
                  ||: ...|..:.|...: .:.|||..||...|..|..|||...|.|.|.          
pombe   250 WLPHVGDCS-GSLFAAFFGCGVLSSYLFLFIGFYINTYIKRGAKKNQRKAAGKAD---------- 303

  Fly   313 HDDLAMPQTTEATA--TATPASKANGSS 338
            :..:|....:||.|  |||.||..:..|
pombe   304 NTSVAAAAGSEALAATTATNASPFSARS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 77/287 (27%)
SPAC1B2.03cNP_593930.1 ELO 50..294 CDD:279492 77/288 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.