DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and Elovl6

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_599210.1 Gene:Elovl6 / 171402 RGDID:620585 Length:267 Species:Rattus norvegicus


Alignment Length:272 Identity:68/272 - (25%)
Similarity:105/272 - (38%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VYLVKVLGPR-LMENRKPLNLQNTLVMYNAIQVVFS--------AWLFYECLMGGWWGSYSFRCQ 98
            :|...:.|.| ||..|....|:..||:::....|||        |::.|..:..|...|.     
  Rat    39 LYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSV----- 98

  Fly    99 PVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYF--SKFTEFMDTIFFV 161
                                      |....| |.|     |...|.|.|  ||..|..||||.:
  Rat    99 --------------------------CDQSFY-NGP-----VSKFWAYAFVLSKAPELGDTIFII 131

  Fly   162 LRKKSSQVTTLHVIHHGCMPMSVWFGVK-FTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQK 225
            |||:  ::..||..||..:.:..|:..| ...||  .:|..:|..||.|||:||...|.|.:..:
  Rat   132 LRKQ--KLIFLHWYHHITVLLYSWYSYKDMVAGG--GWFMTMNYGVHAVMYSYYALRAAGFRVSR 192

  Fly   226 YLWWKKYLTTLQMVQFILIMVHAFQLLF-------IDCNYPKAFVWWIGMHAVMFFFLFNEFYKA 283
            .  :..::|..|:.|.::..|..: |:|       ..|......::|..:..:.:..||..|:..
  Rat   193 K--FAMFITLSQITQMLMGCVINY-LVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLLLFCHFFFE 254

  Fly   284 AYRSRMMKKNGA 295
            ||..::.|...|
  Rat   255 AYIGKVKKATKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 67/268 (25%)
Elovl6NP_599210.1 ELO 25..264 CDD:395916 67/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.