DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and Elovl5

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:313 Identity:108/313 - (34%)
Similarity:164/313 - (52%) Gaps:37/313 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MKYID-SISRYMDS---HSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNT 65
            |::.| |:|.|..:   ..|:|.|||.::.:..||. ||.....|:..|||:.|:||:|.:.:..
  Rat     1 MEHFDASLSTYFRALLGPRDTRVKGWFLLDNYIPTF-VCSAIYLLIVWLGPKYMKNRQPFSCRGI 64

  Fly    66 LVMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDY 130
            ||:||....:.|.::|||.:.|.|.|.|:|.||        .:|..|.|                
  Rat    65 LVVYNLGLTLLSLYMFYELVTGVWEGKYNFFCQ--------GTRSAGES---------------- 105

  Fly   131 SNNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGH 195
                 .::::...|||||||..|||||.||:|||.:.|:|.|||.||..|....||.:.:.|.||
  Rat   106 -----DMKVIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGH 165

  Fly   196 STFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPK 260
            |.|...||:|:|::||:||..|:: |..:.|||||||:|..|:|||:|.::.....:...|::|.
  Rat   166 SYFGATLNSFIHVLMYSYYGLSSV-PSMRPYLWWKKYITQGQLVQFVLTIIQTSCGVIWPCSFPL 229

  Fly   261 AFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINAH 313
            .::::...:.:....||..||...|..:...:......||  .||...::|.|
  Rat   230 GWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKEHLKGH--QNGSMTAVNGH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 92/265 (35%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 92/264 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.