DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and Elovl6

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_569717.1 Gene:Elovl6 / 170439 MGIID:2156528 Length:267 Species:Mus musculus


Alignment Length:272 Identity:68/272 - (25%)
Similarity:105/272 - (38%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VYLVKVLGPR-LMENRKPLNLQNTLVMYNAIQVVFS--------AWLFYECLMGGWWGSYSFRCQ 98
            :|...:.|.| ||..|....|:..||:::....|||        |::.|..:..|...|.     
Mouse    39 LYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSV----- 98

  Fly    99 PVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYF--SKFTEFMDTIFFV 161
                                      |....| |.|     |...|.|.|  ||..|..||||.:
Mouse    99 --------------------------CDQSFY-NGP-----VSKFWAYAFVLSKAPELGDTIFII 131

  Fly   162 LRKKSSQVTTLHVIHHGCMPMSVWFGVK-FTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQK 225
            |||:  ::..||..||..:.:..|:..| ...||  .:|..:|..||.|||:||...|.|.:..:
Mouse   132 LRKQ--KLIFLHWYHHITVLLYSWYSYKDMVAGG--GWFMTMNYGVHAVMYSYYALRAAGFRVSR 192

  Fly   226 YLWWKKYLTTLQMVQFILIMVHAFQLLF-------IDCNYPKAFVWWIGMHAVMFFFLFNEFYKA 283
            .  :..::|..|:.|.::..|..: |:|       ..|......::|..:..:.:..||..|:..
Mouse   193 K--FAMFITLSQITQMLMGCVINY-LVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFE 254

  Fly   284 AYRSRMMKKNGA 295
            ||..::.|...|
Mouse   255 AYIGKVKKATKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 67/268 (25%)
Elovl6NP_569717.1 ELO 25..264 CDD:395916 67/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.