DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and elovl6l

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_958908.1 Gene:elovl6l / 100150288 ZFINID:ZDB-GENE-031110-3 Length:268 Species:Danio rerio


Alignment Length:260 Identity:65/260 - (25%)
Similarity:106/260 - (40%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VYLVKVL-GPRLMENRKPLNLQNTLVMYNAIQVVFS--------AWLFYECLMGGWWGS---YSF 95
            ||:|.|. |...|::|:.|:|:..|:|::....:||        .::.|.....|:..|   .||
Zfish    41 VYVVLVFGGQHFMKDRQRLDLRKVLMMWSLSLAIFSIIGAVRTGCFMLYILSTSGFKQSVCDQSF 105

  Fly    96 RCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSKFTEFMDTIFF 160
            ...|:.            ..|                         || .:..||..|..||:|.
Zfish   106 YYGPIS------------KFW-------------------------AC-AFVLSKAPELGDTMFI 132

  Fly   161 VLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQK 225
            ||||:  ::..||..||..:.:..|:..|....| ..:|..:|..||.:||:||...|.|.:..|
Zfish   133 VLRKQ--RLIFLHWYHHITVLVYSWYSYKDQVAG-GGWFMTMNYTVHALMYSYYAARAAGLRVPK 194

  Fly   226 YLWWKKYLTTLQMVQFIL-IMVHAFQLLFI---DC-NYPKAFVWWIGMHAVMFFFLFNEFYKAAY 285
            ..  ...:|:.|:.|..: :.|.|....::   || :|....||...|: :.:..||:.|:..:|
Zfish   195 PC--AILITSSQIAQMAMDLAVSALVYRWMQDGDCPSYLDNIVWASLMY-LSYLLLFSSFFYQSY 256

  Fly   286  285
            Zfish   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 65/260 (25%)
elovl6lNP_958908.1 ELO 27..264 CDD:279492 65/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.