DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and CAJ1

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_010967.3 Gene:CAJ1 / 856772 SGDID:S000000850 Length:391 Species:Saccharomyces cerevisiae


Alignment Length:67 Identity:22/67 - (32%)
Similarity:41/67 - (61%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   705 KGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKN-KQAGAEEAFKVLQRAFELIGEPENRLIY 768
            |..:.|.|||:.|:::..:|:|.|::.|:..||||: ....|:..|:.:..|::::.:|..|..|
Yeast     3 KETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSDPGLRSKY 67

  Fly   769 DQ 770
            ||
Yeast    68 DQ 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 18/61 (30%)
Jiv90 802..891 CDD:291562
CAJ1NP_010967.3 DnaJ 2..>98 CDD:223560 22/67 (33%)
DnaJ-X 176..376 CDD:405064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.