DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and AT1G77020

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_177828.2 Gene:AT1G77020 / 844038 AraportID:AT1G77020 Length:379 Species:Arabidopsis thaliana


Alignment Length:245 Identity:63/245 - (25%)
Similarity:100/245 - (40%) Gaps:60/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 YSILGVPPDSSQEQIRKHYKKIAVLVHPDKNK-QAGAEEAFKVLQRAFELIGEPENRLIYDQ--- 770
            |.:|||.|.:|:|:|||.|...|..||||||: ...|.|.|:||..|::::.:|.:|..||:   
plant     8 YDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSDPVHREAYDRTGK 72

  Fly   771 --SIAETLHTEKA------WTELHD-------LLSQLQTKMA---EAANTIRCSTCAQRHPRK-- 815
              :..||:....|      .:||.:       :.|...|:||   |.::..:....|.:..|:  
plant    73 FSAPKETMVDPTAVFALLFGSELFEDYIGHLAVASMASTQMASEIENSDQFQDKLKAVQKEREEN 137

  Fly   816 --------LTERPH-----YAARECASCKIRHSAKDGDIWAET----------SMMGLRWKYLAL 857
                    |::..|     :.:|..:..|....|..|.....|          ..:|.|..||. 
plant   138 LSRFLKDFLSQYVHGDKEGFISRAESEAKRLSDAAFGADMLHTIGYVYTRQAAQELGKRALYLG- 201

  Fly   858 MDGKVYDITEWANCQKGALSHLEPNSHMVQYRIVRGAQQQQQQQQQQQQQ 907
                |..:.||.. .||       :|...|....:||.|..|.|::..::
plant   202 ----VPFVAEWVR-NKG-------HSWKSQISAAKGALQLLQLQEESNRR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 26/59 (44%)
Jiv90 802..891 CDD:291562 20/113 (18%)
AT1G77020NP_177828.2 DnaJ 7..>72 CDD:223560 28/63 (44%)
DnaJ 7..68 CDD:278647 26/59 (44%)
DnaJ-X 131..318 CDD:291006 24/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.