DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and SARNP

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_149073.1 Gene:SARNP / 84324 HGNCID:24432 Length:210 Species:Homo sapiens


Alignment Length:180 Identity:40/180 - (22%)
Similarity:68/180 - (37%) Gaps:32/180 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 EANEMDVVLETSIAQQPQVPNQNLQQPEPLSQSVNTLPAASKPAKSLKMPLATATVSPTAINKSS 303
            ||||.||:.:.:..::.:.....:::.||..::|:.  ||.|     |:...|:.:..|...:..
Human    49 EANEEDVLGDETEEEETKPIELPVKEEEPPEKTVDV--AAEK-----KVVKITSEIPQTERMQKR 106

  Fly   304 VA---VPGQPEGKKRIVAEVKPMPMSYSDVLSKGTKPSAAGRDMRADNGGDYSVQSQRRPEKEDA 365
            ..   ||...|.||    ..:......|.|.:||         :.:||  ...|...:..|:...
Human   107 AERFNVPVSLESKK----AARAARFGISSVPTKG---------LSSDN--KPMVNLDKLKERAQR 156

  Fly   366 YGNREMRTSKRS----PLHDAKETGSFV---PGVGHAHASRGKKRSKVSQ 408
            :|......|::|    .|...||....|   .|.|....:..|||.:..:
Human   157 FGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAER 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647
Jiv90 802..891 CDD:291562
SARNPNP_149073.1 PLN03124 7..>90 CDD:215591 12/47 (26%)
SAP 8..42 CDD:128789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..86 9/38 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..210 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.