DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and ARL2

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_176206.2 Gene:ARL2 / 842292 AraportID:AT1G59980 Length:414 Species:Arabidopsis thaliana


Alignment Length:180 Identity:51/180 - (28%)
Similarity:85/180 - (47%) Gaps:41/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   694 GEEAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKN-KQAGAEEAFKVLQRAFE 757
            |||.     ..:.::.|.:||:|.:|:.::|:..|:::|:..||||| ....|.|.||.:..|:|
plant    14 GEED-----ELRRRNPYEVLGIPSNSTDQEIKSAYRRMALRYHPDKNPDDPVAAEMFKEVTFAYE 73

  Fly   758 LIGEPENRLIYDQSIAETLHTEKAWTELHDLLS-----------------QLQTK-----MAEAA 800
            ::.:||||.:||.:.:|.:..|....|| ||.|                 |::|.     :.||.
plant    74 VLSDPENRRLYDTTGSEAVGPENEDLEL-DLSSLGAVNTIFAALFNKLGVQIKTTVSANLLGEAL 137

  Fly   801 N---TIRCSTCAQRHPRKLTER-PHY--------AARECASCKIRHSAKD 838
            |   |.......|...||:.:: .|:        .|::...||:..|||:
plant   138 NGTVTTLPLMVGQVVSRKVEKQSAHFYSVTLTEEEAQDGLICKVHSSAKN 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 23/61 (38%)
Jiv90 802..891 CDD:291562 11/46 (24%)
ARL2NP_176206.2 PRK14295 11..>176 CDD:237665 46/167 (28%)
DnaJ 23..85 CDD:365959 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.