powered by:
Protein Alignment CG14650 and AT5G37380
DIOPT Version :9
Sequence 1: | NP_649473.1 |
Gene: | CG14650 / 40566 |
FlyBaseID: | FBgn0037252 |
Length: | 970 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001078673.1 |
Gene: | AT5G37380 / 833712 |
AraportID: | AT5G37380 |
Length: | 431 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 28/71 - (39%) |
Similarity: | 45/71 - (63%) |
Gaps: | 2/71 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 708 DAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQSI 772
|.|.||...|....|.:::.|:|:|:::||||||..|||.|||.:..|::.:.:.|.|..||:
plant 66 DWYGILNASPRDDDETLKRKYRKLALMLHPDKNKSIGAEGAFKHVSEAWKFLSDKEKRAAYDR-- 128
Fly 773 AETLHT 778
.::||:
plant 129 RKSLHS 134
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14650 | NP_649473.1 |
DnaJ |
708..769 |
CDD:278647 |
24/60 (40%) |
Jiv90 |
802..891 |
CDD:291562 |
|
AT5G37380 | NP_001078673.1 |
DnaJ |
66..127 |
CDD:278647 |
24/60 (40%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.