DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and AT5G03030

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001331589.1 Gene:AT5G03030 / 831703 AraportID:AT5G03030 Length:152 Species:Arabidopsis thaliana


Alignment Length:168 Identity:39/168 - (23%)
Similarity:63/168 - (37%) Gaps:48/168 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 WLF-YLVYDIVVLGFSMGYERITLAYVAALAYARQLQKELKQNSGKPSIWWRSYWRRFDARFAKN 663
            :|| ||....:..|::.....|..|.|||.|.|           |:..|   ..|:.|.||    
plant    25 FLFLYLTLVFIGSGYTQATPMIAGAAVAAAAVA-----------GRYGI---LAWQAFKAR---- 71

  Fly   664 SRLAVWRLFYKRKPPETTSEQFKTGRLPQTGEEAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHY 728
            .|:...|.||                     |....|.:.  .::|..||||......:::::.:
plant    72 PRVPRMRRFY---------------------EGGFQSSMT--RREAALILGVRESVVADKVKEAH 113

  Fly   729 KKIAVLVHPDKNKQAGAEE--AFKVLQRAFELIGEPEN 764
            :::.|..|||    ||...  |.|:.:....::|:..|
plant   114 RRVMVANHPD----AGGSHYLASKINEAKDMMLGKSNN 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 15/59 (25%)
Jiv90 802..891 CDD:291562
AT5G03030NP_001331589.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.