DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and ATJ6

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_196308.1 Gene:ATJ6 / 830582 AraportID:AT5G06910 Length:284 Species:Arabidopsis thaliana


Alignment Length:129 Identity:40/129 - (31%)
Similarity:68/129 - (52%) Gaps:12/129 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   674 KRKPPETTSEQFKTGRLPQTGEEAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPD 738
            |:|...:|:|:.:. .:...|..:..||        |.:|||...::.::|||.|.|:|:.:|||
plant     4 KKKSRASTTEEDEI-EMDNAGPSSETSL--------YEVLGVERRATSQEIRKAYHKLALKLHPD 59

  Fly   739 KNK-QAGAEEAFKVLQRAFELIGEPENRLIYDQ--SIAETLHTEKAWTELHDLLSQLQTKMAEA 799
            ||: ...|::.|:.||:...::|:.|.|.:|||  ||.:......|:..|.|....:..|:.||
plant    60 KNQDDKEAKDKFQQLQKVISILGDEEKRAVYDQTGSIDDADIPGDAFENLRDFFRDMYKKVNEA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 22/61 (36%)
Jiv90 802..891 CDD:291562
ATJ6NP_196308.1 DnaJ 29..91 CDD:395170 24/69 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.