powered by:
Protein Alignment CG14650 and AT5G05750
DIOPT Version :9
Sequence 1: | NP_649473.1 |
Gene: | CG14650 / 40566 |
FlyBaseID: | FBgn0037252 |
Length: | 970 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_196194.1 |
Gene: | AT5G05750 / 830459 |
AraportID: | AT5G05750 |
Length: | 294 |
Species: | Arabidopsis thaliana |
Alignment Length: | 65 |
Identity: | 31/65 - (47%) |
Similarity: | 44/65 - (67%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 707 KDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQS 771
||.|.|||:..:.|.|.:||.|:|:::.|||||||..|:|||||.:.:||:.:...:.|..||.|
plant 113 KDYYEILGLKSNCSVEDLRKSYRKLSLKVHPDKNKAPGSEEAFKSVSKAFQCLSNEDTRRKYDGS 177
Fly 772 771
plant 178 177
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14650 | NP_649473.1 |
DnaJ |
708..769 |
CDD:278647 |
27/60 (45%) |
Jiv90 |
802..891 |
CDD:291562 |
|
AT5G05750 | NP_196194.1 |
DnaJ |
110..>217 |
CDD:223560 |
31/65 (48%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1173544at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.