DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and NdhT

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_192673.1 Gene:NdhT / 826517 AraportID:AT4G09350 Length:249 Species:Arabidopsis thaliana


Alignment Length:176 Identity:43/176 - (24%)
Similarity:71/176 - (40%) Gaps:22/176 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   617 YERITLAYVAALAYARQLQKELKQNSGKPSIWWRSYWRRFDARFAKNSRLAVWRLFYKRKPPETT 681
            :.|||...|..: ||.  |...|.:...|.:..|.:|...|..:...           |..|..:
plant    32 FRRITARRVTRI-YAS--QGPTKPSKPSPGVDTRIHWESPDEGWIGG-----------RSDPAKS 82

  Fly   682 SEQFKTGRLPQTGEEAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNK--QAG 744
            .::.||..|   .:|....|:.......|..|||..|:..|:|:..|::::...|||...  ...
plant    83 VDEDKTNLL---SDEKFAELIKDSFDSHYQFLGVSTDADLEEIKSAYRRLSKEYHPDTTSLPLKT 144

  Fly   745 AEEAFKVLQRAFELIGEPENRLIYDQSIAETL---HTEKAWTELHD 787
            |.|.|..|:..:.::.:.|.|..||.::|:.:   ..||...:|.|
plant   145 ASEKFMKLREVYNVLSDEETRRFYDWTLAQEVASRQAEKMRMKLED 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 17/62 (27%)
Jiv90 802..891 CDD:291562
NdhTNP_192673.1 DnaJ 106..169 CDD:278647 17/62 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.