DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and ATERDJ3B

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_191819.1 Gene:ATERDJ3B / 825434 AraportID:AT3G62600 Length:346 Species:Arabidopsis thaliana


Alignment Length:75 Identity:30/75 - (40%)
Similarity:47/75 - (62%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 YSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEA---FKVLQRAFELIG 760
            |::....||..|.:|.||..:|.|||::.|:|:|:..|||||:  |.|||   |..:..|:|::.
plant    17 YAICVLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQ--GNEEATRKFAEINNAYEVLS 79

  Fly   761 EPENRLIYDQ 770
            :.|.|.||::
plant    80 DEEKREIYNK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 26/63 (41%)
Jiv90 802..891 CDD:291562
ATERDJ3BNP_191819.1 DnaJ 23..343 CDD:223560 29/69 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.