DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and AT3G57340

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_191293.1 Gene:AT3G57340 / 824901 AraportID:AT3G57340 Length:367 Species:Arabidopsis thaliana


Alignment Length:112 Identity:40/112 - (35%)
Similarity:65/112 - (58%) Gaps:5/112 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 AKNSRLAVWRLFYKRKPPETTSEQFKTGRLPQTGEE-AMYSLLNCKGKDAYSILGVPPDSSQEQI 724
            ||:|..:..|...:::...|||   .:..:..|.|: ::...:..| ||.|.|||:..:.|.:.:
plant    69 AKDSSNSSDRPSLRQRGSSTTS---SSSSMSYTEEQISIVRKIKSK-KDYYEILGLESNCSVDDV 129

  Fly   725 RKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQS 771
            ||.|:|:::.||||||:..|:|||||.:.:||:.:...|.|..||.|
plant   130 RKAYRKLSLKVHPDKNQAPGSEEAFKSVSKAFQCLSNDEARKKYDVS 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 26/60 (43%)
Jiv90 802..891 CDD:291562
AT3G57340NP_191293.1 DnaJ 109..>210 CDD:223560 31/69 (45%)
DnaJ 113..174 CDD:278647 26/60 (43%)
DUF1977 277..361 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.