DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and AT3G09700

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_566352.1 Gene:AT3G09700 / 820127 AraportID:AT3G09700 Length:112 Species:Arabidopsis thaliana


Alignment Length:109 Identity:25/109 - (22%)
Similarity:47/109 - (43%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   658 ARFAKNSRLAVWRLFYKRKPPETTSEQFKTGRLPQTGEEAMYSLLNCKGKDAYSILGVPPDSSQE 722
            |.:|....:..|:.| |.:|......:|..|....|          ...::|..||||....:.|
plant    14 AAYAGKYGIEAWQAF-KLRPVRPRMRKFYEGGFQAT----------MNRREAALILGVRESVAAE 67

  Fly   723 QIRKHYKKIAVLVHPDKNKQAGAEE--AFKVLQRAFELIGEPEN 764
            ::::.::::.|..|||    ||...  |.|:.:....::|:.:|
plant    68 KVKEAHRRVMVANHPD----AGGSHYLASKINEAKDMMLGKTKN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 16/59 (27%)
Jiv90 802..891 CDD:291562
AT3G09700NP_566352.1 DnaJ <44..103 CDD:413365 15/72 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.