DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and Dnaja4

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001344804.1 Gene:Dnaja4 / 58233 MGIID:1927638 Length:426 Species:Mus musculus


Alignment Length:299 Identity:67/299 - (22%)
Similarity:108/299 - (36%) Gaps:98/299 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 KPPETTSEQFKTGRLPQTGEEAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKN 740
            :|.|.|||        :.|::.:      |....|.||||.|.:|.|:|:|.|:|:|:..|||||
Mouse    17 QPEEQTSE--------ENGDKMV------KETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKN 67

  Fly   741 KQAGAEEAFKVLQRAFELIGEPENRLIYDQSIAETLH---------------------------- 777
            ...|  |.||::.:|:|::.:|:.|.||||...:.:.                            
Mouse    68 PDEG--EKFKLISQAYEVLSDPKKRDIYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFGGGGRMTR 130

  Fly   778 -------TEKAWTELHDLLSQLQTKMAEAANTIRCSTCAQRHPRKLTERPHYAARECASCKIRHS 835
                   ..:....|.||.:.:..|:|...|.| |..|.....:|      .:..:|..||.|  
Mouse   131 ERRGKNVVHQLSVTLEDLYNGITKKLALQKNVI-CEKCEGIGGKK------GSVEKCPLCKGR-- 186

  Fly   836 AKDGDIWAETSMMGLRWKYLALMDGKVYDI-TEWANCQKGALSHLEPNSH--------------M 885
                         |::.....:..|.|..| |....| ||....:.|...              :
Mouse   187 -------------GMQVHIQQIGPGMVQQIQTVCIEC-KGQGERINPKDRCENCSGAKVTREKKI 237

  Fly   886 VQYRIVRGAQQQQQQQQQQQQQQQQQHHQHPQQPHHDRG 924
            ::..:.:|         .:..|:...|.:..|:|..|.|
Mouse   238 IEVHVEKG---------MKDGQKILFHGEGDQEPELDPG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 27/60 (45%)
Jiv90 802..891 CDD:291562 17/103 (17%)
Dnaja4NP_001344804.1 DnaJ 15..423 CDD:333066 67/299 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.