DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and Dnajc7

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_030102048.1 Gene:Dnajc7 / 56354 MGIID:1928373 Length:579 Species:Mus musculus


Alignment Length:569 Identity:119/569 - (20%)
Similarity:189/569 - (33%) Gaps:139/569 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 QPEPL-SQSVNTLPAASKPAKSLKMPLATA--TVSPTAINKSSVAVPGQPEGKKRIVAEVKPMPM 325
            |.||| .:.....|:....|:.|..|..:|  .:.||.::        .|.||....||      
Mouse    41 QAEPLVGRRARGSPSGRGAAERLDAPTGSALHRLPPTRLS--------GPGGKMAATAE------ 91

  Fly   326 SYSDVLSKGTKPSA-----AGRDMRA--DNGGDYSVQSQRR-------------PEKEDAYGNRE 370
              .||:...|:|..     |.|:..:  :.|..|..:....             |.....||||.
Mouse    92 --CDVVMAATEPELLEDEDAKREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRA 154

  Fly   371 ----MRTSKRSPLHDAKET----GSFVPG---VGHAHASRGKKRSKVSQTAPLKVQQSQSLAQPN 424
                |....|..|.||:::    .|||.|   .|..|.|.|.     :..|....|::..|...|
Mouse   155 ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGN-----AMAACRSFQRALELDHKN 214

  Fly   425 LQPQIKSNKLNNPEKKRPLQPKNVNS--NAPKFSEHKTTPVSANSSLQNHSNVLNFTPATNSSTS 487
            .|.|              .:.||.|:  ...|.:|...........:......|.|.||.:    
Mouse   215 AQAQ--------------QEFKNANAVMEYEKIAEVDFEKRDFRKVVFCMDRALEFAPACH---- 261

  Fly   488 SRKSGSNKINSNASHSNHTGANTHAGSSSSSSSVNYSS----------NNNVSSSSAKRYSSSNL 542
              :....|....|....:..|...|.......|.|..:          .:.:..:......:..:
Mouse   262 --RFKILKAECLAMLGRYPEAQFVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRM 324

  Fly   543 NPNNSSGYSYSSKRNRSNAYSSTNSPTHANSFSSNRNYELAKRIIHTWWIYTLKLLTWLFYLVYD 607
            .|::.......     .||.:........|......||:||      :.:||             
Mouse   325 APDHEKACVAC-----RNAKALKAKKEDGNKAFKEGNYKLA------YELYT------------- 365

  Fly   608 IVVLGFSMGYERITLAYVAAL--------AYARQLQKELKQ--NSGK-PSIWWRSYWRRFDARFA 661
                 .::|.:...:...|.|        :..|||:..::.  |:.| ...:.::|.||......
Mouse   366 -----EALGIDPNNIKTNAKLYCNRGTVNSKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMD 425

  Fly   662 KNSRLAVWRLFYKRKPPETTSEQFKTGRLPQTGEEAMYSLLNCKGKDAYSILGVPPDSSQEQIRK 726
            ........|.:.|....|.|.|.      .|..:.|...|...|.||.|.||||..::|:::|:|
Mouse   426 TEQFEEAVRDYEKVYQTEKTKEH------KQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKK 484

  Fly   727 HYKKIAVLVHPDKNKQAGA------EEAFKVLQRAFELIGEPENRLIYD 769
            .|:|.|::.|||::..|.|      |:.||.:..||.::.:|:.:..||
Mouse   485 AYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYD 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 23/66 (35%)
Jiv90 802..891 CDD:291562
Dnajc7XP_030102048.1 AANH_like <19..91 CDD:381925 14/57 (25%)
3a0801s09 104..>438 CDD:273380 65/387 (17%)
TPR repeat 113..141 CDD:276809 2/27 (7%)
TPR repeat 146..176 CDD:276809 9/29 (31%)
TPR repeat 181..209 CDD:276809 8/32 (25%)
TPR repeat 230..255 CDD:276809 2/24 (8%)
TPR repeat 260..290 CDD:276809 4/35 (11%)
TPR repeat 295..323 CDD:276809 0/27 (0%)
TPR repeat 342..369 CDD:276809 7/50 (14%)
TPR repeat 374..408 CDD:276809 6/33 (18%)
TPR repeat 413..441 CDD:276809 5/27 (19%)
DnaJ 465..>554 CDD:223560 26/69 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.