DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14650 and DNAJC3

DIOPT Version :9

Sequence 1:	NP_649473.1	Gene:	CG14650 / 40566	FlyBaseID:	FBgn0037252	Length:	970	Species:	Drosophila melanogaster
Sequence 2:	XP_011519406.1	Gene:	DNAJC3 / 5611	HGNCID:	9439	Length:	533	Species:	Homo sapiens

Alignment Length:	96	Identity:	30/96 - (31%)
Similarity:	53/96 - (55%)	Gaps:	5/96 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   679 ETTSEQFKTGRLPQTG-EEAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPD---- 738
            ||..|..:..:..:.| |:|...|...:.:|.|.||||..::.:::|.|.|:|:|:..|||
Human   393 ETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQN 457

  Fly   739 KNKQAGAEEAFKVLQRAFELIGEPENRLIYD 769
            :.::..||:.|..:..|.|::.:||.|..:|
Human   458 EEEKKKAEKKFIDIAAAKEVLSDPEMRKKFD 488

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14650	NP_649473.1	DnaJ	708..769	CDD:278647	22/64 (34%)
CG14650	NP_649473.1	Jiv90	802..891	CDD:291562
DNAJC3	XP_011519406.1	TPR_11	36..100	CDD:290150
		TPR repeat	37..65	CDD:276809
		TPR repeat	70..100	CDD:276809
		TPR_11	73..132	CDD:290150
		TPR repeat	105..132	CDD:276809
		TPR_11	182..246	CDD:290150
		TPR repeat	186..211	CDD:276809
		TPR_11	216..281	CDD:290150
		TPR repeat	216..246	CDD:276809
		TPR repeat	251..279	CDD:276809
		TPR repeat	285..309	CDD:276809
		TPR repeat	330..364	CDD:276809
		TPR_19	347..411	CDD:291240	4/17 (24%)
		TPR_1	369..402	CDD:278916	3/8 (38%)
		TPR repeat	369..397	CDD:276809	2/3 (67%)
		TPR repeat	403..426	CDD:276809	5/22 (23%)
		DnaJ	421..>527	CDD:223560	23/68 (34%)
		DnaJ	423..488	CDD:278647	22/64 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910