Sequence 1: | NP_649473.1 | Gene: | CG14650 / 40566 | FlyBaseID: | FBgn0037252 | Length: | 970 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061072.3 | Gene: | DNAJA4 / 55466 | HGNCID: | 14885 | Length: | 426 | Species: | Homo sapiens |
Alignment Length: | 294 | Identity: | 64/294 - (21%) |
---|---|---|---|
Similarity: | 109/294 - (37%) | Gaps: | 90/294 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 692 QTGEEAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAF 756
Fly 757 ELIGEPENRLIYDQSIAETLH-----------------------------------TEKAWTELH 786
Fly 787 DLLSQLQTKMAEAANTIRCSTCAQRHPRKLTERPHYAARECASCKIRHSAKDGDIWAETSMMGLR 851
Fly 852 WKYLALMDGKVYDI-TEWANCQKGALSHLEPNSH--------------MVQYRIVRGAQQQQQ-- 899
Fly 900 ---QQQQQQQQQ--------QQQHHQHPQQPHHD 922 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14650 | NP_649473.1 | DnaJ | 708..769 | CDD:278647 | 26/60 (43%) |
Jiv90 | 802..891 | CDD:291562 | 17/103 (17%) | ||
DNAJA4 | NP_061072.3 | PTZ00037 | 15..423 | CDD:240236 | 64/294 (22%) |
DnaJ | 36..94 | CDD:278647 | 26/59 (44%) | ||
DnaJ_C | 135..361 | CDD:199909 | 31/176 (18%) | ||
DnaJ_zf | 164..230 | CDD:199908 | 16/87 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |