DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and DNAJA4

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_061072.3 Gene:DNAJA4 / 55466 HGNCID:14885 Length:426 Species:Homo sapiens


Alignment Length:294 Identity:64/294 - (21%)
Similarity:109/294 - (37%) Gaps:90/294 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 QTGEEAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAF 756
            ||.|:..:.::  |....|.||||.|.:|.|:|:|.|:|:|:..|||||...|  |.||::.:|:
Human    21 QTPEKPRHKMV--KETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEG--EKFKLISQAY 81

  Fly   757 ELIGEPENRLIYDQSIAETLH-----------------------------------TEKAWTELH 786
            |::.:|:.|.:|||...:.:.                                   ..:....|.
Human    82 EVLSDPKKRDVYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFGGGGRMARERRGKNVVHQLSVTLE 146

  Fly   787 DLLSQLQTKMAEAANTIRCSTCAQRHPRKLTERPHYAARECASCKIRHSAKDGDIWAETSMMGLR 851
            ||.:.:..|:|...|.| |..|.....:|      .:..:|..||.|               |::
Human   147 DLYNGVTKKLALQKNVI-CEKCEGVGGKK------GSVEKCPLCKGR---------------GMQ 189

  Fly   852 WKYLALMDGKVYDI-TEWANCQKGALSHLEPNSH--------------MVQYRIVRGAQQQQQ-- 899
            .....:..|.|..| |....| ||....:.|...              :::..:.:|.:..|:  
Human   190 IHIQQIGPGMVQQIQTVCIEC-KGQGERINPKDRCESCSGAKVIREKKIIEVHVEKGMKDGQKIL 253

  Fly   900 ---QQQQQQQQQ--------QQQHHQHPQQPHHD 922
               :..|:.:.:        .|:.|...|:..||
Human   254 FHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 26/60 (43%)
Jiv90 802..891 CDD:291562 17/103 (17%)
DNAJA4NP_061072.3 PTZ00037 15..423 CDD:240236 64/294 (22%)
DnaJ 36..94 CDD:278647 26/59 (44%)
DnaJ_C 135..361 CDD:199909 31/176 (18%)
DnaJ_zf 164..230 CDD:199908 16/87 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.