DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and DNAJC17

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_016877890.1 Gene:DNAJC17 / 55192 HGNCID:25556 Length:308 Species:Homo sapiens


Alignment Length:224 Identity:47/224 - (20%)
Similarity:85/224 - (37%) Gaps:54/224 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   720 SQEQIRKHYKKIAVLVHPDKN-KQAGAEEAFKVLQRAFELIGEPENRLIYD-------------Q 770
            |..|::|.|::.|:..||||| ....|.|.|..|.:|.|::.:...|..||             |
Human    27 SSWQVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVLTDAAARAAYDKVRKAKKQAAERTQ 91

  Fly   771 SIAETLHTEKAWTELHDLLSQLQTKMAEAANTIRCSTCAQRHPRKLTERP-----------HYAA 824
            .:.|  ..:|...:|.....|.|.:.:|.....|.:...::...:|.|..           ....
Human    92 KLDE--KRKKVKLDLEARERQAQAQESEEEEESRSTRTLEQEIERLREEGSRQLEEQQRLIREQI 154

  Fly   825 RECASCKIRHSAKDGDIWAETSMMGLRWK---------------YLALMD--GKVYDITEWANCQ 872
            |:....::|..|::.: ...|..:.|:||               .|.|:.  |:|.::       
Human   155 RQERDQRLRGKAENTE-GQGTPKLKLKWKCKKEDESKGGYSKDVLLRLLQKYGEVLNL------- 211

  Fly   873 KGALSHLEPNSHMVQYRIVRGAQQQQQQQ 901
              .||..:|.:.:|::..|:.|:...|.:
Human   212 --VLSSKKPGTAVVEFATVKAAELAVQNE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 17/49 (35%)
Jiv90 802..891 CDD:291562 18/116 (16%)
DNAJC17XP_016877890.1 DnaJ <30..77 CDD:278647 16/46 (35%)
RRM_DNAJC17 188..251 CDD:240875 11/60 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.