DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and dnajc28

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001017648.1 Gene:dnajc28 / 550341 ZFINID:ZDB-GENE-050417-130 Length:376 Species:Danio rerio


Alignment Length:100 Identity:23/100 - (23%)
Similarity:44/100 - (44%) Gaps:18/100 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 TSEQFKTGRLPQTGEEAMYSLLNCKGKDAYSILGVPPD--SSQEQIRKHYKKIAVLVHPDKNKQA 743
            |...|.:|.|.:       ||     :::|.:|.:|.|  |...::::.|.::|.|.|||.....
Zfish    25 TLRSFSSGALSR-------SL-----RESYRLLQLPDDGASGPAEVKEAYLRMAKLYHPDSGAPT 77

  Fly   744 GAEEAFKVLQRAFELI----GEPENRLIYDQSIAE 774
            ...:.|..::.|:..:    ...::...|.||:.|
Zfish    78 ADADLFSQIEEAYRAVLAHLARQKSASQYTQSMEE 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 13/66 (20%)
Jiv90 802..891 CDD:291562
dnajc28NP_001017648.1 DnaJ 42..91 CDD:197617 13/48 (27%)
DUF1992 197..265 CDD:286440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.