DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and dnajb12

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001015991.1 Gene:dnajb12 / 548745 XenbaseID:XB-GENE-944288 Length:373 Species:Xenopus tropicalis


Alignment Length:216 Identity:58/216 - (26%)
Similarity:90/216 - (41%) Gaps:42/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 AALAYARQLQKELKQNSGKPSIWWRSYWRRFDARFAKNSRLAVWRLFYKRKPPETTSEQFKTGRL 690
            |...|....||...:||            :.|:....|.||.      |.....|.|...:.|  
 Frog    43 AQALYESLSQKSQPENS------------QSDSTETTNPRLR------KNAADSTPSANGEAG-- 87

  Fly   691 PQTGE-------EAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEA 748
            .:||:       ||:..:..|  ||.|.||||..:::::.::|.|:|:|:..|||||...||.||
 Frog    88 GETGKSYTPDQLEAVKRIKQC--KDYYEILGVTREATEDDLKKSYRKLALKFHPDKNHAPGATEA 150

  Fly   749 FKVLQRAFELIGEPENRLIYDQSIAETLHTEK-AWTELH----------DLLSQLQTKMAEAANT 802
            ||.:..|:.::...|.|..|||...|.:.:.: ..::.|          ||.:........|:|.
 Frog   151 FKAIGNAYAVLSNTEKRKQYDQFGEEKVSSSRHGHSDFHRGFEADISPEDLFNMFFGGGFPASNV 215

  Fly   803 IRCSTCAQR--HPRKLTERPH 821
            ...|....|  :|::...|.|
 Frog   216 HVYSNGRMRYTYPQRQDRREH 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 24/60 (40%)
Jiv90 802..891 CDD:291562 5/22 (23%)
dnajb12NP_001015991.1 DnaJ 110..171 CDD:278647 24/60 (40%)
DUF1977 266..364 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.