powered by:
Protein Alignment CG14650 and dnajb2
DIOPT Version :9
Sequence 1: | NP_649473.1 |
Gene: | CG14650 / 40566 |
FlyBaseID: | FBgn0037252 |
Length: | 970 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012825839.2 |
Gene: | dnajb2 / 548454 |
XenbaseID: | XB-GENE-951530 |
Length: | 361 |
Species: | Xenopus tropicalis |
Alignment Length: | 64 |
Identity: | 28/64 - (43%) |
Similarity: | 42/64 - (65%) |
Gaps: | 2/64 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 708 DAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKN--KQAGAEEAFKVLQRAFELIGEPENRLIYD 769
|.|.|||||.::||:.|::.|:|:|:..||||| .:..||..||.:..|:|::.:.|.|..||
Frog 3 DYYDILGVPRNASQDDIKRAYRKLALRWHPDKNPDNKEHAERKFKDIAEAYEVLSDGEKREAYD 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14650 | NP_649473.1 |
DnaJ |
708..769 |
CDD:278647 |
26/62 (42%) |
Jiv90 |
802..891 |
CDD:291562 |
|
dnajb2 | XP_012825839.2 |
PRK10767 |
3..>106 |
CDD:236757 |
28/64 (44%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.