DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and DNAJB12

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001352009.1 Gene:DNAJB12 / 54788 HGNCID:14891 Length:377 Species:Homo sapiens


Alignment Length:80 Identity:34/80 - (42%)
Similarity:48/80 - (60%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 TGEE--AMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRA 755
            |.|:  |:..:..|  ||.|.||||...:|.|.::|.|:::|:..|||||...||.||||.:..|
Human    95 TAEQVAAVKRVKQC--KDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTA 157

  Fly   756 FELIGEPENRLIYDQ 770
            :.::..||.|..|||
Human   158 YAVLSNPEKRKQYDQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 26/60 (43%)
Jiv90 802..891 CDD:291562
DNAJB12NP_001352009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..92
DnaJ 110..>236 CDD:333066 29/63 (46%)
DUF1977 268..368 CDD:312722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.