DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and AT3G06778

DIOPT Version :10

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001078117.1 Gene:AT3G06778 / 5007987 AraportID:AT3G06778 Length:229 Species:Arabidopsis thaliana


Alignment Length:58 Identity:24/58 - (41%)
Similarity:35/58 - (60%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 DAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENR 765
            |.|.|||:..|:..:.|||.|.|:|:.||||||....|:.|||::..|:..:.:...|
plant    42 DWYLILGIQEDAEVKVIRKRYHKLALKVHPDKNNHPKADIAFKLIHEAYLCLSDETKR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:395170 24/58 (41%)
Jiv90 800..891 CDD:464360
AT3G06778NP_001078117.1 DnaJ 42..103 CDD:395170 24/58 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.