DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and Dph4

DIOPT Version :10

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster


Alignment Length:102 Identity:30/102 - (29%)
Similarity:53/102 - (51%) Gaps:14/102 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 DAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQ-----AGAE---EAFKVLQRAFELIGEPEN 764
            |.|.:|.||..:|.::|:..||::.:..||||.:|     .|:|   ..|..:..|:..:.:|..
  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67

  Fly   765 RLIYDQSIAETLHTE-KAWTELHD--LLSQLQTKMAE 798
            |..||   ||.|.:: :|.:.::.  :||::|....|
  Fly    68 RKHYD---AELLQSKFRAHSNIYATVVLSEMQRIQVE 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:395170 20/68 (29%)
Jiv90 800..891 CDD:464360
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 20/68 (29%)
zf-CSL <138..179 CDD:398744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.