DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and dnajc5gb

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_005158621.1 Gene:dnajc5gb / 393371 ZFINID:ZDB-GENE-040426-1238 Length:212 Species:Danio rerio


Alignment Length:136 Identity:39/136 - (28%)
Similarity:58/136 - (42%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   679 ETTSEQFKTGRLPQTGEEAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKN-KQ 742
            ||:..|.|..|               .|:..|..||:...:|.|.|:|.|:|:|:..||||| ..
Zfish     3 ETSRPQRKLSR---------------AGESLYQTLGLQKGASSEDIKKAYRKLALKHHPDKNPNN 52

  Fly   743 AGAEEAFKVLQRAFELIGEPENRLIYDQSIAETLHTEKAWTE----LHDLLSQLQTKMAEAANTI 803
            ..|.|.||.:..|..::.:...|.|||:..:..|:....:.|    .:.|:|:...|......||
Zfish    53 PEAAEKFKEINNANSILNDETKRQIYDEYGSMGLYIADQFGEDSVKYYFLMSKCWFKTLLCIGTI 117

  Fly   804 -RCSTC 808
             .|..|
Zfish   118 LTCCCC 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 22/61 (36%)
Jiv90 802..891 CDD:291562 4/8 (50%)
dnajc5gbXP_005158621.1 DnaJ 14..>86 CDD:223560 25/71 (35%)
DnaJ 17..79 CDD:278647 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.