DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and CG7387

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster


Alignment Length:264 Identity:52/264 - (19%)
Similarity:86/264 - (32%) Gaps:96/264 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   672 FYKRKP---PETTSEQFKT--GRLPQTGEEAMYSLLNCKG--KD-AYSILGVPPDSSQEQIRKHY 728
            |...||   |:...|..:|  |..||............:|  || .|.:|||...::.:|||..:
  Fly    56 FRTTKPAYYPDRQREAKRTSAGATPQQVSSPAVKYPQSRGMPKDYYYKVLGVNRHATIQQIRSAF 120

  Fly   729 KKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQSIAETLHTEKAWTE--------- 784
            ..:|...|||........:.|:.|..|:.::.:...||.|||  ...:..|:|:.|         
  Fly   121 YALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQ--LGGIKDERAFLEQAGNPLNVG 183

  Fly   785 ------------LHDLLSQLQT-----------------KMAEAANTIRCSTC-------AQRHP 813
                        .:|.:::|::                 |..|.....:|.||       |.|..
  Fly   184 LEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIELRYLRKCETCKGKSQLMAHRDV 248

  Fly   814 RK------------LTERPHYAA-RECASCK----------------------------IRHSAK 837
            .|            :|:.|.::: ..|..||                            :...::
  Fly   249 GKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSR 313

  Fly   838 DGDI 841
            |||:
  Fly   314 DGDV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 17/61 (28%)
Jiv90 802..891 CDD:291562 14/88 (16%)
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 40/219 (18%)
DnaJ 101..161 CDD:278647 16/59 (27%)
DnaJ_zf 233..296 CDD:199908 11/62 (18%)
DnaJ_C 298..416 CDD:199909 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.