DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and Tpr2

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001260501.1 Gene:Tpr2 / 34984 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster


Alignment Length:560 Identity:109/560 - (19%)
Similarity:182/560 - (32%) Gaps:175/560 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 KMPLATATVSPTAINKSSVAVPGQ----PEGKKRIVAEVKPMPMSYSDVLSKGTKPSAAGRDMRA 346
            :|.:...|..||...|:...||..    .|.||::                        |.|   
  Fly    21 EMDVEITTEQPTIDVKAEQIVPKDAATIAEEKKKL------------------------GND--- 58

  Fly   347 DNGGDYSVQSQRR------------PEKEDAYGNRE----MRTSKRSPLHDAKETGSFVPGVGHA 395
                .|..|:.:.            |:....||||.    |..:..|.|.||:......||...|
  Fly    59 ----QYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKA 119

  Fly   396 HASRGKKRSKV-----SQTAPLKVQQSQSLAQPNLQPQIKSNKLNNPEKKRPLQPKNVNSNAPKF 455
            :....|....:     ::.|...|.:..||:......|..:.||...|                 
  Fly   120 YVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLE----------------- 167

  Fly   456 SEHKTTPVSANSSLQNHSNV-------LNFTPATNSSTSSRKSGSNKINSNASHSNHTGANTHAG 513
                 ..:.||...:::.||       |...||. ......|:...........:.....:....
  Fly   168 -----ATIQANYDTKSYRNVVFYLDSALKLAPAC-LKYRLLKAECLAFLGRCDEALDIAVSVMKL 226

  Fly   514 SSSSSSSV-------NYSSNNNVSSSSAKRYSSSNLNPNNSSGYSYSSKRNRSNAYSSTNSPTHA 571
            .::|:.::       .|:.|.:......:|  :..|:|::     |.||:.||..........:.
  Fly   227 DTTSADAIYVRGLCLYYTDNLDKGILHFER--ALTLDPDH-----YKSKQMRSKCKQLKEMKENG 284

  Fly   572 NSFSSNRNYELAKRIIHTWWIYT-------------LKLLTWLFYLVYDIVVLGFSMGYERITLA 623
            |....:..|    |..|.  |||             .|||       |:..::...:|..|..:|
  Fly   285 NMLFKSGRY----REAHV--IYTDALKIDEHNKDINSKLL-------YNRALVNTRIGNLREAVA 336

  Fly   624 -----------YVAALAYARQLQKELKQNSGKPSIWWRSYWRRFDARFAKNSRLAVWRLFYKRKP 677
                       |:.||....:...:|:               :|:...|..              
  Fly   337 DCNRVLELNSQYLKALLLRARCYNDLE---------------KFEESVADY-------------- 372

  Fly   678 PETTSEQFKTGRLPQTGEEAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQ 742
             ||..:..||..:.:...||.::|...|.||.|.|||:..::|.::|:|.|:|.|::.|||::..
  Fly   373 -ETALQLEKTPEIKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHAN 436

  Fly   743 AGAEE------AFKVLQRAFELIGEPENRLIYD--QSIAE 774
            :.|||      .||.:..|:.::.:...:..||  |.|.|
  Fly   437 SSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEE 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 20/66 (30%)
Jiv90 802..891 CDD:291562
Tpr2NP_001260501.1 TPR_11 49..114 CDD:290150 17/95 (18%)
TPR repeat 49..77 CDD:276809 7/58 (12%)
TPR repeat 82..112 CDD:276809 9/29 (31%)
TPR_11 201..262 CDD:290150 6/62 (10%)
TPR repeat 201..225 CDD:276809 1/23 (4%)
TPR_1 231..264 CDD:278916 5/34 (15%)
TPR repeat 231..259 CDD:276809 3/29 (10%)
TPR_11 278..345 CDD:290150 14/79 (18%)
TPR repeat 310..344 CDD:276809 7/40 (18%)
TPR_11 314..380 CDD:290150 15/102 (15%)
TPR repeat 349..377 CDD:276809 7/57 (12%)
DnaJ 401..>503 CDD:223560 26/76 (34%)
DnaJ 402..469 CDD:278647 20/66 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.