DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14650 and DNAJA1

DIOPT Version :9

Sequence 1:	NP_649473.1	Gene:	CG14650 / 40566	FlyBaseID:	FBgn0037252	Length:	970	Species:	Drosophila melanogaster
Sequence 2:	NP_001530.1	Gene:	DNAJA1 / 3301	HGNCID:	5229	Length:	397	Species:	Homo sapiens

Alignment Length:	158	Identity:	43/158 - (27%)
Similarity:	69/158 - (43%)	Gaps:	47/158 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly   710 YSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYD----Q 770
            |.:|||.|:::||:::|.|:|:|:..|||||...|  |.||.:.:|:|::.:.:.|.:||    |
Human     8 YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEG--EKFKQISQAYEVLSDAKKRELYDKGGEQ 70

  Fly   771 SIAE--------------------------------TLHTEKAWTELHDLLSQLQTKMAEAANTI 803
            :|.|                                .:|  :....|.||.:....|:|...|.|
Human    71 AIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVH--QLSVTLEDLYNGATRKLALQKNVI 133

  Fly   804 RCSTCAQRHPRKLTERPHYAARECASCK 831
             |..|..|..:|      .|...|.:|:
Human   134 -CDKCEGRGGKK------GAVECCPNCR 154

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14650	NP_649473.1	DnaJ	708..769	CDD:278647	23/58 (40%)
CG14650	NP_649473.1	Jiv90	802..891	CDD:291562	8/30 (27%)
DNAJA1	NP_001530.1	PTZ00037	2..394	CDD:240236	43/158 (27%)
		CXXCXGXG motif	134..141		2/6 (33%)
		CXXCXGXG motif	150..157		2/5 (40%)
		CXXCXGXG motif	177..184
		CXXCXGXG motif	193..200
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	352..397
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910