DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and dnajb12a

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_997824.1 Gene:dnajb12a / 324005 ZFINID:ZDB-GENE-030131-2725 Length:371 Species:Danio rerio


Alignment Length:89 Identity:36/89 - (40%)
Similarity:51/89 - (57%) Gaps:4/89 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   691 PQTGE--EAMYSLLNCKGKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQ 753
            |.|.|  :|:..:..|  ||.|..|||..::|:|.::|.|:|:|:..|||||...||.||||.:.
Zfish    91 PYTSEQLDAVKRIKRC--KDYYETLGVSKEASEEDLKKAYRKLALKFHPDKNHAPGATEAFKAIG 153

  Fly   754 RAFELIGEPENRLIYDQSIAETLH 777
            .|:.::..||.|..||....|..|
Zfish   154 NAYAVLSNPEKRRQYDVYGEEKAH 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 26/60 (43%)
Jiv90 802..891 CDD:291562
dnajb12aNP_997824.1 DnaJ 107..>211 CDD:223560 31/71 (44%)
DnaJ 108..169 CDD:278647 26/60 (43%)
DUF1977 263..363 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.