DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and dnaja1

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_955956.1 Gene:dnaja1 / 323922 ZFINID:ZDB-GENE-030131-2642 Length:398 Species:Danio rerio


Alignment Length:285 Identity:70/285 - (24%)
Similarity:110/285 - (38%) Gaps:82/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 YSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQSIAE 774
            |.:|||.|.:|.|:::|.|:|:|:..|||||...|  |.||.:.:|:|::.:.:.|.:||:.   
Zfish     8 YDMLGVKPSASPEELKKAYRKLALKYHPDKNPTEG--EKFKQISQAYEVLSDAKKREVYDRG--- 67

  Fly   775 TLHTEKAWTELHDLLSQLQTKMAEAANTIRCSTCAQRHPRKLTE-------RPHYAARECASCKI 832
               .|||              :.|..|...||      |..:.:       |.|   ||.....:
Zfish    68 ---GEKA--------------IKEGGNGGSCS------PMDIFDLFFGGGGRMH---RERRGKNV 106

  Fly   833 RH--SAKDGDIWAETSMMGLRWKYLALMDGKVYDITEWANCQKGA---------------LSHLE 880
            .|  :....|::..|:      :.|||....:.|..|....:||.               |.||.
Zfish   107 VHQLTVSLEDLYNGTT------RKLALQKNVICDKCEGRGGRKGVIEVCPLCRGVGVQVRLHHLA 165

  Fly   881 PNSHMVQY--RIVRGAQQQQQQQQQQQQQQQQQHHQHPQQP-----HHDRGV--------HHPGG 930
            |.  |||.  .:..|.|.|.|:...:.:.:.....:..:|.     |.|:|:        |..|.
Zfish   166 PG--MVQQISTVCEGCQGQGQRLGHRDRCKTCTGRKILRQKKILEVHIDKGMKDGQKIVFHGEGD 228

  Fly   931 GVSGVSEATLHEFLDN----LYSGQ 951
            ...|:....:...||.    ||:.|
Zfish   229 QEPGLKPGDIIIVLDQRAHPLYTRQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 23/58 (40%)
Jiv90 802..891 CDD:291562 24/114 (21%)
dnaja1NP_955956.1 PTZ00037 2..395 CDD:240236 70/285 (25%)
DnaJ 7..65 CDD:278647 23/58 (40%)
DnaJ_C 104..330 CDD:199909 33/158 (21%)
DnaJ_zf 133..199 CDD:199908 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.