DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and Dnajc18

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_006254608.1 Gene:Dnajc18 / 291677 RGDID:1310237 Length:357 Species:Rattus norvegicus


Alignment Length:99 Identity:38/99 - (38%)
Similarity:56/99 - (56%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   674 KRKPPETTSEQFKTGRLPQT-GEEAMYSLLNCKG-KDAYSILGVPPDSSQEQIRKHYKKIAVLVH 736
            |.|..|....|.:.|....| .||.:..:...|. ::.|.||||..::|.|:::|.|||:|:..|
  Rat    46 KEKKSENEWSQTRQGDGNATYTEEQLRGVQRIKKCRNYYDILGVSHNASDEELKKAYKKLALKFH 110

  Fly   737 PDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQ 770
            ||||...||.:|||.:..||.::..|:.||.||:
  Rat   111 PDKNCAPGATDAFKAIGNAFAVLSNPDKRLRYDE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 27/60 (45%)
Jiv90 802..891 CDD:291562
Dnajc18XP_006254608.1 DnaJ 82..143 CDD:278647 27/60 (45%)
DUF1977 250..349 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.