powered by:
Protein Alignment CG14650 and SPBC3E7.11c
DIOPT Version :9
Sequence 1: | NP_649473.1 |
Gene: | CG14650 / 40566 |
FlyBaseID: | FBgn0037252 |
Length: | 970 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_596098.1 |
Gene: | SPBC3E7.11c / 2540676 |
PomBaseID: | SPBC3E7.11c |
Length: | 355 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 66 |
Identity: | 24/66 - (36%) |
Similarity: | 43/66 - (65%) |
Gaps: | 2/66 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 707 KDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQ--AGAEEAFKVLQRAFELIGEPENRLIYD 769
:|.|.||.:..|:..:.|:|.|:::|:|.|||||:: ..|.|.|:.|..|::::.:|:.|..||
pombe 8 RDYYDILNISVDADGDTIKKSYRRLAILYHPDKNRENPEAAREKFQKLAEAYQVLSDPKLREKYD 72
Fly 770 Q 770
:
pombe 73 K 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.