DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and mug184

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_595124.1 Gene:mug184 / 2540016 PomBaseID:SPBC1773.09c Length:551 Species:Schizosaccharomyces pombe


Alignment Length:79 Identity:29/79 - (36%)
Similarity:44/79 - (55%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 DAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEE----AFKVLQRAFELIGEPENRLIY 768
            |.|:||.:..:::.:||||.|..:|:..|||:|  .|.||    .|:.||.|.|::.:...||||
pombe    12 DYYAILKLQKNATFQQIRKQYLFLALQYHPDRN--PGDEERAVKRFQRLQLAHEVLSDATKRLIY 74

  Fly   769 DQSIAETLHTEKAW 782
            ||....:..|...:
pombe    75 DQLFGLSTRTRSQY 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 25/64 (39%)
Jiv90 802..891 CDD:291562
mug184NP_595124.1 DnaJ 11..>79 CDD:223560 28/68 (41%)
DnaJ 12..75 CDD:278647 25/64 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.