DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and cwf23

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_587857.2 Gene:cwf23 / 2539268 PomBaseID:SPCC10H11.02 Length:289 Species:Schizosaccharomyces pombe


Alignment Length:289 Identity:60/289 - (20%)
Similarity:102/289 - (35%) Gaps:101/289 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 DAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKN-KQAGAEEAFKVLQRAFELIGEPENRLIYD-- 769
            |.|.:||:..|:..::|.:.::|.::..||||| ....|.|.|.:||.|:..:.:.:.|..||  
pombe     9 DYYELLGINEDAQDQEIHRAWRKTSLKYHPDKNPNDPKAAEKFHMLQLAYNALIDVQLRKAYDSE 73

  Fly   770 ------------------QSIAETLH---------TEKAWTELHDLLSQLQTKMAEAANTIRCST 807
                              :|:.:.|.         .||...|...|..:|:....|:||..|   
pombe    74 RFAKLARKRREEAFNFQRKSMVDDLRERERQFYDSLEKKENERDRLQEKLRALQEESANLRR--- 135

  Fly   808 CAQRHPRKLTERPHYAAR--ECASCKIRHSAKDGDIWAETSMMGLRWK----------YL----- 855
              ||..|...|:.....|  |..|.||  |..|..|       .:|||          ||     
pombe   136 --QRENRLREEQEQSKRRKQETPSSKI--SELDRSI-------RIRWKRKYADQVNDAYLRSIYS 189

  Fly   856 --------------------------------------ALMDGKVYDITEWANCQK-GALSHLEP 881
                                                  |....|:||: :|....| .:.:..|.
pombe   190 SFGTLQNVVIQKDISKEKKYVYSIIVFETLSSAYSAINAEKPSKIYDV-QWLKPPKSNSNTPTEK 253

  Fly   882 NSHMVQYRIVRGAQQQQQQQQQQQQQQQQ 910
            ::.:..|..:...:.:|:.:|:|::.:::
pombe   254 DTTVEDYEEITIMRMKQKHKQKQKENERK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 19/61 (31%)
Jiv90 802..891 CDD:291562 26/144 (18%)
cwf23NP_587857.2 DnaJ 9..71 CDD:278647 19/61 (31%)
DnaJ 9..>71 CDD:223560 19/61 (31%)
RRM_SF 165..240 CDD:302621 10/82 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.