DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and CG30156

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster


Alignment Length:177 Identity:47/177 - (26%)
Similarity:82/177 - (46%) Gaps:38/177 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   607 DIVVLGFSMGYERITLAYVAALAYARQLQKELK--QNSGKPSIWWRSYWRRFDARFA----KNSR 665
            |.||....:|:      |..||   ||:.::|:  ||              .|...|    ||  
  Fly    13 DKVVSDLCLGH------YEHAL---RQINEDLEGLQN--------------HDEIMALLELKN-- 52

  Fly   666 LAVWRLFYKRKPPETTSEQFKTGRLPQ--TGE--EAMYSLLNCKGKDAYSILGVPPDSSQEQIRK 726
             .:.||..|.:...|.....|:..||.  |.|  :.:..:|.|  ::.|.:|.:...::..::::
  Fly    53 -IILRLRLKGEAQRTIGPTRKSDALPHKFTLEMLDVVQKVLRC--RNHYEVLRISHHATYSEVKR 114

  Fly   727 HYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQSIA 773
            .|.|:|:.:||||||..|||:||:.:..|.:.:.:.:.|:.|:.:.|
  Fly   115 AYHKLALRLHPDKNKSPGAEQAFRRISEAADCLTDCQKRIEYNIATA 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 18/60 (30%)
Jiv90 802..891 CDD:291562
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 18/60 (30%)
DUF1977 237..334 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.