powered by:
Protein Alignment CG14650 and dnj-23
DIOPT Version :9
Sequence 1: | NP_649473.1 |
Gene: | CG14650 / 40566 |
FlyBaseID: | FBgn0037252 |
Length: | 970 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495944.1 |
Gene: | dnj-23 / 174451 |
WormBaseID: | WBGene00001041 |
Length: | 242 |
Species: | Caenorhabditis elegans |
Alignment Length: | 87 |
Identity: | 26/87 - (29%) |
Similarity: | 47/87 - (54%) |
Gaps: | 16/87 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 710 YSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEE-------AFKVLQRAFELIGEPENRLI 767
|.:|||..|..::.::|.|.:.::..||||:.. .|| .|::|.:|::::.:.|.|.|
Worm 16 YELLGVKKDCDEKALKKGYYRQSMRWHPDKSNL--VEEDMQTYTTKFQLLNKAYQILSDEEKRKI 78
Fly 768 YDQS-----IAETLHTE--KAW 782
||:: .|..|:.: |||
Worm 79 YDETGSVDDEAGELNEDALKAW 100
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14650 | NP_649473.1 |
DnaJ |
708..769 |
CDD:278647 |
19/65 (29%) |
Jiv90 |
802..891 |
CDD:291562 |
|
dnj-23 | NP_495944.1 |
DnaJ |
14..80 |
CDD:365959 |
19/65 (29%) |
CbpA |
15..240 |
CDD:225124 |
26/87 (30%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.