DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and dnj-8

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001040753.1 Gene:dnj-8 / 174093 WormBaseID:WBGene00001026 Length:813 Species:Caenorhabditis elegans


Alignment Length:142 Identity:35/142 - (24%)
Similarity:59/142 - (41%) Gaps:34/142 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 KDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYD-- 769
            :|.|.:||:...:|.::|:..||.:|...||||.|...|...|..:..|:|::.:|..:..||  
 Worm    21 EDPYKVLGISRRASAKEIKSAYKSLAREWHPDKRKDEAASGRFMEIAEAYEVLSDPLRKERYDRF 85

  Fly   770 ---------QSIAETLHT------------EKAWTELHDLLS--QLQTKMAEAANT--------- 802
                     :..||...:            :::..|....:|  |.|.|:.|.:||         
 Worm    86 GTFDDVKQFEDNAERARSFYGFGGFGGFGFDESVFEYKYRMSYQQYQFKILEESNTKPYIVYIYS 150

  Fly   803 IRCSTCAQRHPR 814
            ..|..|.:.||:
 Worm   151 NYCQMCYRFHPQ 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 19/60 (32%)
Jiv90 802..891 CDD:291562 5/22 (23%)
dnj-8NP_001040753.1 DnaJ_bact 22..>86 CDD:274090 21/63 (33%)
TRX_DnaJ 118..229 CDD:239261 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.