DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14650 and AgaP_AGAP010239

DIOPT Version :9

Sequence 1:	NP_649473.1	Gene:	CG14650 / 40566	FlyBaseID:	FBgn0037252	Length:	970	Species:	Drosophila melanogaster
Sequence 2:	XP_319428.4	Gene:	AgaP_AGAP010239 / 1279661	VectorBaseID:	AGAP010239	Length:	345	Species:	Anopheles gambiae

Alignment Length:	65	Identity:	31/65 - (47%)
Similarity:	45/65 - (69%)	Gaps:	0/65 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   706 GKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQ 770
            |||.|..||:|..|:.|.|:|.|:|:|:..||||||..||||.||.:..|:|::.:.:.|.:||:
Mosquito     2 GKDYYKTLGIPRGSTDEDIKKAYRKLALKYHPDKNKSPGAEEKFKEVAEAYEVLSDKKKREMYDK 66

Fly 771 770
Mosquito 67 66

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14650	NP_649473.1	DnaJ	708..769	CDD:278647	27/60 (45%)
CG14650	NP_649473.1	Jiv90	802..891	CDD:291562
AgaP_AGAP010239	XP_319428.4	DnaJ	1..338	CDD:223560	31/65 (48%)
		DnaJ	4..65	CDD:278647	27/60 (45%)
		DnaJ_C	166..330	CDD:199909
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910