DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and AgaP_AGAP010141

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_319298.3 Gene:AgaP_AGAP010141 / 1279561 VectorBaseID:AGAP010141 Length:210 Species:Anopheles gambiae


Alignment Length:133 Identity:30/133 - (22%)
Similarity:64/133 - (48%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   698 MYSLLNCK--GKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGA---EEAFKVLQRAFE 757
            |..:.:|:  .:..|::|.:.|:.|...:|..:.:::..:|||.|....|   :::|..|..|::
Mosquito    10 MLHIYHCRYTHRTHYNVLKLQPNCSARDVRTAFIQLSKELHPDANVSNQAKYDKKSFVELLEAYK 74

  Fly   758 LIGEPENRLIYDQSIAETLHTEKAWTELHDLLSQLQTKMAEAANTIRCSTCAQRHPRKLTERPHY 822
            ::.:||:|..||..::   .::....:::..|....|....||||:..|.         .|:|:|
Mosquito    75 VLSKPESRAAYDYELS---LSKNPGNQVYVNLLTNSTYRPWAANTMHYSN---------EEQPYY 127

  Fly   823 AAR 825
            ..:
Mosquito   128 GIK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 16/63 (25%)
Jiv90 802..891 CDD:291562 5/24 (21%)
AgaP_AGAP010141XP_319298.3 DnaJ 22..86 CDD:278647 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.