powered by:
Protein Alignment CG14650 and AgaP_AGAP004849
DIOPT Version :9
Sequence 1: | NP_649473.1 |
Gene: | CG14650 / 40566 |
FlyBaseID: | FBgn0037252 |
Length: | 970 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_314342.3 |
Gene: | AgaP_AGAP004849 / 1275118 |
VectorBaseID: | AGAP004849 |
Length: | 284 |
Species: | Anopheles gambiae |
Alignment Length: | 67 |
Identity: | 21/67 - (31%) |
Similarity: | 42/67 - (62%) |
Gaps: | 3/67 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 707 KDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEA---FKVLQRAFELIGEPENRLIY 768
|:.|.:.||...:|.::|:|.|.::::..|||:..::..:|| ||||.:.:.::...::|.||
Mosquito 14 KNIYELFGVEKSASDQEIKKAYYRLSLQTHPDRVPESDKQEATEKFKVLSKLYNILSNKDSRAIY 78
Fly 769 DQ 770
|:
Mosquito 79 DE 80
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14650 | NP_649473.1 |
DnaJ |
708..769 |
CDD:278647 |
18/63 (29%) |
Jiv90 |
802..891 |
CDD:291562 |
|
AgaP_AGAP004849 | XP_314342.3 |
CbpA |
13..223 |
CDD:225124 |
21/67 (31%) |
DnaJ |
17..79 |
CDD:278647 |
18/61 (30%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.