DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and AgaP_AGAP004849

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_314342.3 Gene:AgaP_AGAP004849 / 1275118 VectorBaseID:AGAP004849 Length:284 Species:Anopheles gambiae


Alignment Length:67 Identity:21/67 - (31%)
Similarity:42/67 - (62%) Gaps:3/67 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   707 KDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEA---FKVLQRAFELIGEPENRLIY 768
            |:.|.:.||...:|.::|:|.|.::::..|||:..::..:||   ||||.:.:.::...::|.||
Mosquito    14 KNIYELFGVEKSASDQEIKKAYYRLSLQTHPDRVPESDKQEATEKFKVLSKLYNILSNKDSRAIY 78

  Fly   769 DQ 770
            |:
Mosquito    79 DE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 18/63 (29%)
Jiv90 802..891 CDD:291562
AgaP_AGAP004849XP_314342.3 CbpA 13..223 CDD:225124 21/67 (31%)
DnaJ 17..79 CDD:278647 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.