DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and AgaP_AGAP000008

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_311152.5 Gene:AgaP_AGAP000008 / 1272268 VectorBaseID:AGAP000008 Length:407 Species:Anopheles gambiae


Alignment Length:161 Identity:40/161 - (24%)
Similarity:68/161 - (42%) Gaps:50/161 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 YSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQ---- 770
            |.||||.|..:.::::|.|:|:|:..|||||...|  |.||.:..|:|::.:||.:.|||:    
Mosquito     8 YDILGVAPSCTPDELKKAYRKLALKYHPDKNPNEG--EKFKQISMAYEVLSDPEKKAIYDEGGEA 70

  Fly   771 -----------------------------------SIAETLHTEKAWTELHDLLSQLQTKMAEAA 800
                                               ..:..:||..  ..|.:|.:..:.|:|...
Mosquito    71 AIKQGAGGGGGGFHSPMDIFHMFFNGGFSGRKNERQTSNVIHTLS--VTLEELYTGTKRKLALQK 133

  Fly   801 NTIRCSTCAQRHPRKLTERPHYAARECASCK 831
            |.| |.:|.....::      .|:::||.|:
Mosquito   134 NVI-CESCEGIGGKR------GASQKCAPCR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 24/58 (41%)
Jiv90 802..891 CDD:291562 7/30 (23%)
AgaP_AGAP000008XP_311152.5 PTZ00037 6..399 CDD:240236 40/161 (25%)
DnaJ 7..65 CDD:278647 24/58 (41%)
DnaJ_C 108..335 CDD:199909 14/59 (24%)
DnaJ_zf 137..203 CDD:199908 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.