DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14650 and AgaP_AGAP007541

DIOPT Version :9

Sequence 1:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_308338.4 Gene:AgaP_AGAP007541 / 1269693 VectorBaseID:AGAP007541 Length:681 Species:Anopheles gambiae


Alignment Length:349 Identity:72/349 - (20%)
Similarity:125/349 - (35%) Gaps:105/349 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   651 SYWRRFDARFAK-NSRLAVWRLFYKRKP-----PETTSEQFKTGRLP-QTGE--------EAMYS 700
            :|.||..|...| :..|...:..::.:|     |.|..|...:|.|| ..|:        ||::.
Mosquito    24 NYDRRRSAAGTKWDETLEYLQYLHETQPIVPKCPPTKDELIASGALPADAGQNAPAAVDPEALFE 88

  Fly   701 LL--------------NCKGKDAYSILGVPP---DSSQEQIRKHYKKIAVLVHPDKNKQAGA--- 745
            .|              :.|.:|.|.:||:..   .::.|.|::.|:||.:..||||.|..|.   
Mosquito    89 ELFAVDIDYLKSLDPKDWKNQDHYHVLGLNKMRFTATDEDIKRAYRKIVLKHHPDKRKALGENVK 153

  Fly   746 --EEAFKVLQRAFELIGEPENRLIYDQ---------------------SIAETLHTEKAWTELHD 787
              ::.|..:..|:|.:|..:||..:|.                     |:|:.......|.|   
Mosquito   154 QDDDYFHCITMAYETLGTVKNRRAFDSIDPEFDDSLPSQAEVEKDFFGSLADVFKRNARWNE--- 215

  Fly   788 LLSQLQTKMAEAANTIRCSTCAQRHPRKLTERPHY--------AARECASCKIRHSAKDGD---- 840
              |:....:....||          ||:..|  |:        :.||.:........|..|    
Mosquito   216 --SRKAAPLLGDDNT----------PREAVE--HFYDFWYNFQSWREFSYLDEEDKEKGQDREER 266

  Fly   841 IWAETSMMGLRWK--------YLALM------DGKVYDITEWANCQKGALSHLEPNSHMVQ---- 887
            .|.|.....:|.|        ..||:      |.:|.........:|.|....:..::.||    
Mosquito   267 RWIEKQNKAIRLKRKKEESARIRALVDLAYNNDPRVVRFKREEKERKLAAKRAKQTAYQVQKAEE 331

  Fly   888 YRIVRGAQQQQQQQQQQQQQQQQQ 911
            .|:.:.|.:.:|:.::.:|::.:|
Mosquito   332 ERVAKEAAEAKQRAEEAEQKRIEQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14650NP_649473.1 DnaJ 708..769 CDD:278647 21/68 (31%)
Jiv90 802..891 CDD:291562 22/118 (19%)
AgaP_AGAP007541XP_308338.4 ZUO1 72..427 CDD:227594 59/301 (20%)
DnaJ 110..179 CDD:278647 21/68 (31%)
RAC_head 367..432 CDD:293322
SANT 618..667 CDD:197842
SANT 620..667 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.