powered by:
Protein Alignment CG14650 and DNAJB4
DIOPT Version :9
Sequence 1: | NP_649473.1 |
Gene: | CG14650 / 40566 |
FlyBaseID: | FBgn0037252 |
Length: | 970 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001304028.1 |
Gene: | DNAJB4 / 11080 |
HGNCID: | 14886 |
Length: | 337 |
Species: | Homo sapiens |
Alignment Length: | 65 |
Identity: | 33/65 - (50%) |
Similarity: | 44/65 - (67%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 706 GKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQ 770
|||.|.|||:...:|.|.|:|.|:|.|:..||||||...|||.||.:..|:|::.:|:.|.||||
Human 2 GKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQ 66
Fly 771 770
Human 67 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14650 | NP_649473.1 |
DnaJ |
708..769 |
CDD:278647 |
28/60 (47%) |
Jiv90 |
802..891 |
CDD:291562 |
|
DNAJB4 | NP_001304028.1 |
DnaJ |
1..332 |
CDD:223560 |
33/65 (51%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.